PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_09796
Common NameKK1_010077
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family NF-YB
Protein Properties Length: 169aa    MW: 18524.7 Da    PI: 6.9327
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_09796genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB180.12e-5624117194
          NF-YB   1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94 
                    vreqdr+lPian+srimkk+lPan+ki+kdaketvqecvsefisf+tseasdkcqrekrktingddllwa+atlGfedy++plk+yl++yr+ +
  C.cajan_09796  24 VREQDRYLPIANISRIMKKALPANGKIAKDAKETVQECVSEFISFITSEASDKCQREKRKTINGDDLLWAMATLGFEDYIDPLKIYLNRYRDGD 117
                    69*****************************************************************************************865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.109.6E-5421135IPR009072Histone-fold
SuperFamilySSF471131.46E-3927127IPR009072Histone-fold
PfamPF008083.2E-283094IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.3E-205876No hitNo description
PROSITE patternPS0068506177IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.3E-207795No hitNo description
PRINTSPR006151.3E-2096114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 169 aa     Download sequence    Send to blast
MAEGPASPGC GSHESSDHSP RSNVREQDRY LPIANISRIM KKALPANGKI AKDAKETVQE  60
CVSEFISFIT SEASDKCQRE KRKTINGDDL LWAMATLGFE DYIDPLKIYL NRYRDGDTKG  120
SAKGGESSAK KDVQPSPNAQ LAHQGTFSQS VSYTNSQGQH MMVPMQGPE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_B7e-4823115294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A7e-4823115294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003521372.11e-115PREDICTED: nuclear transcription factor Y subunit B-10
SwissprotQ8VYK42e-84NFYB8_ARATH; Nuclear transcription factor Y subunit B-8
TrEMBLA0A151TUT71e-126A0A151TUT7_CAJCA; Nuclear transcription factor Y subunit B-8
STRINGGLYMA03G33490.11e-115(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF25453382
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37060.39e-86nuclear factor Y, subunit B8